PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MA_30848g0010
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family MYB
Protein Properties Length: 295aa    MW: 32616.5 Da    PI: 7.7756
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MA_30848g0010genomeConGenIEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.41.2e-161764148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT eEd +l+++++ +G+g+W++ a+  g+ R++k+c++rw +yl
    MA_30848g0010 17 KGPWTYEEDIRLLRYITIHGPGRWSALAKASGLQRCGKSCRLRWVNYL 64
                     79********************************************97 PP

2Myb_DNA-binding56.66.1e-1870115148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg+ T+eE+ +++d+++++G++ W++Ia++m+ gRt++++k++w+++l
    MA_30848g0010  70 RGSITPEEESIILDLHARWGNR-WSLIAEKMP-GRTDNEIKNYWRSHL 115
                      7889******************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.4241264IPR017930Myb domain
SuperFamilySSF466893.52E-3015111IPR009057Homeodomain-like
SMARTSM007176.9E-121666IPR001005SANT/Myb domain
PfamPF002493.5E-141764IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.8E-231871IPR009057Homeodomain-like
CDDcd001673.35E-91964No hitNo description
PROSITE profilePS5129426.84665119IPR017930Myb domain
SMARTSM007175.5E-1769117IPR001005SANT/Myb domain
PfamPF002495.0E-1670115IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.2E-2672119IPR009057Homeodomain-like
CDDcd001673.79E-1274115No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 295 aa     Download sequence    Send to blast
MNSKWSKSCE RAGKLKKGPW TYEEDIRLLR YITIHGPGRW SALAKASGLQ RCGKSCRLRW  60
VNYLRPDLKR GSITPEEESI ILDLHARWGN RWSLIAEKMP GRTDNEIKNY WRSHLKKKLS  120
TSHPSEDSYD VNKITTSLPQ LVTASHAVMA NHALQPLRSS SSNEDNTENR VHVNPQPNLA  180
ASHFLESVFN ATNLSCTDCS WQKQSGEEPV FRATSADAHT ALVSLKEEQN ELASCGSLEQ  240
DALSAILCQL YSAIPGGGGA DKAAAAMSAV NASAYSSYNY DCDSTLDLSG LWNIS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C8e-301511925128MYB TRANSFORMING PROTEIN
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEF6765690.0EF676569.1 Picea sitchensis clone WS02742_K03 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012843202.11e-53PREDICTED: transcription factor MYB21-like
TrEMBLB8LLD70.0B8LLD7_PICSI; Putative uncharacterized protein
STRINGGLYMA06G45460.11e-51(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G13480.11e-53myb domain protein 79